PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA7091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 304aa    MW: 35116 Da    PI: 5.1899
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA7091genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-1680123146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               rg+++++E+el+++ +++lG++ W+ Ia++++ gRt++++k++w++
  Tp57577_TGAC_v2_mRNA7091  80 RGAFSQQEEELIIHFHTLLGNR-WSQIAARLP-GRTDNEIKNFWNS 123
                               89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.239174IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.9E-86486IPR009057Homeodomain-like
SuperFamilySSF466892.98E-1964135IPR009057Homeodomain-like
PROSITE profilePS5129425.21275129IPR017930Myb domain
SMARTSM007177.3E-1579127IPR001005SANT/Myb domain
PfamPF002492.8E-1480123IPR001005SANT/Myb domain
CDDcd001674.10E-1082122No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2087126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDCKTIMDEL KSRGKLRMYW GRILKSSLIY XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXSCRLRW INYLRPDLKR GAFSQQEEEL IIHFHTLLGN RWSQIAARLP GRTDNEIKNF  120
WNSTIKKKLK NLSSTSPNAS DESSPEPNKD LNTQGSYIST QQHANYNNYM NMPMFTSSSP  180
SMLQNTIFNT MNIDTLPMLD HGGSYFNNGV EIIKDSYLEN GVFGSVNIGV QEEVCKKETN  240
NSDYYFGDIN INTILNNCNI IESNNNKIEN RSEVVENLYQ EQFNLGELEF EELMKDVSSF  300
LFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-206612945108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597423.21e-125myb transcription factor
TrEMBLG7IS011e-125G7IS01_MEDTR; Myb transcription factor
STRINGGLYMA11G14200.24e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-40myb domain protein 46